Annexin IV Antikörper (Middle Region)

Produktnummer ABIN634614

Dieses Anti-Annexin IV-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Annexin IV in WB. Geeignet für Chemical.

Kurzübersicht für Annexin IV Antikörper (Middle Region) (ABIN634614)

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin IV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Annexin IV Antikörper

Bindungsspezifität: Middle Region

Spezifität: Annexin A4 antibody was raised against the middle region of ANXA4

Kreuzreaktivität: Human

Aufreinigung: Affinity purified

Immunogen: Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A4 Blocking Peptide, (ABIN937807), is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin IV

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Andere Bezeichnung: Annexin A4

Substanzklasse: Chemical

Hintergrund: Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 gene has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity.

Molekulargewicht: 36 kDa (MW of target protein)