Annexin IV Antikörper (Middle Region)

Produktnummer ABIN5518805

Produktdetails anti-Annexin IV Antikörper

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Bindungsspezifität: AA 119-152, Middle Region

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin IV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Annexin A4(ANXA4) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: EEIRRISQTY QQQYGRSLED DIRSDTSFMF QRVL

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for Annexin A4(ANXA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: annexin A4
Protein Name: Annexin A4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related mouse and rat sequences by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-Annexin IV Antikörper (ABIN5518805)

Manville, Abbott: "Ancient and modern anticonvulsants act synergistically in a KCNQ potassium channel binding pocket." in: Nature communications, Vol. 9, Issue 1, pp. 3845, (2018) (PubMed).

Details zu Annexin IV

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Andere Bezeichnung: ANXA4 (ANXA4 Produkte)

Synonyme: ANXA4 antikoerper, Anx4 antikoerper, XAnx4 antikoerper, pig28 antikoerper, X-anx4 antikoerper, Xanx-4 antikoerper, ANXIV antikoerper, anx4 antikoerper, ANX4 antikoerper, PIG28 antikoerper, ZAP36 antikoerper, Annexin-4 antikoerper, P32.5 antikoerper, PAP-II antikoerper, PP4-X antikoerper, AI265406 antikoerper, AIV antikoerper, AW106930 antikoerper, annexin A4 antikoerper, annexin A4 L homeolog antikoerper, ANXA4 antikoerper, anxa4 antikoerper, CC1G_00713 antikoerper, LOC100280951 antikoerper, Anxa4 antikoerper, anxa4.L antikoerper

Hintergrund: ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells.

Synonyms: Annexin A4 | 35-beta calcimedin | Annexin IV | Annexin-4 | Carbohydrate-binding protein p33/p41 | Chromobindin-4 | Endonexin I | Lipocortin IV | P32.5 | PP4-X | Placental anticoagulant protein II | PAP-II | Protein II | ANXA4 | ANX4 | P09525

Gen-ID: 307

UniProt: P09525