TUBB Antikörper (N-Term)

Produktnummer ABIN634598

Der Kaninchen Polyklonal Anti-TUBB-Antikörper wurde für WB validiert. Er ist geeignet, TUBB in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für TUBB Antikörper (N-Term) (ABIN634598)

Target: TUBB (Tubulin, beta (TUBB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TUBB Antikörper

Bindungsspezifität: N-Term

Spezifität: Beta Tubulin antibody was raised against the N terminal of TUBB

Aufreinigung: Affinity purified

Immunogen: Beta Tubulin antibody was raised using the N terminal of TUBB corresponding to a region with amino acids YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Tubulin Blocking Peptide, (ABIN936086), is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBB

Target: TUBB (Tubulin, beta (TUBB))

Andere Bezeichnung: beta Tubulin

Hintergrund: TUBB belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics, M Phase