PPP1R13B Antikörper

Produktnummer ABIN634596

Dieses Anti-PPP1R13B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PPP1R13B in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PPP1R13B Antikörper (ABIN634596)

Target: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R13B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PPP1R13B Antikörper

Aufreinigung: Affinity purified

Immunogen: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP1R13B Blocking Peptide, (ABIN937786), is also available for use as a blocking control in assays to test for specificity of this PPP1R13B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R13B

Target: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Andere Bezeichnung: PPP1R13B

Hintergrund: PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.

Molekulargewicht: 119 kDa (MW of target protein)

Pathways: p53 Signalweg