SERPINB2 Antikörper

Produktnummer ABIN634589

Der Kaninchen Polyklonal Anti-SERPINB2-Antikörper wurde für WB validiert. Er ist geeignet, SERPINB2 in Proben von Human und Maus zu detektieren.

Kurzübersicht für SERPINB2 Antikörper (ABIN634589)

Target: SERPINB2 (Plasminogen Activator Inhibitor 2 (SERPINB2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPINB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SERPINB2 Antikörper

Aufreinigung: Affinity purified

Immunogen: SERPINB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINB2 Blocking Peptide, (ABIN938752), is also available for use as a blocking control in assays to test for specificity of this SERPINB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPINB2

Target: SERPINB2 (Plasminogen Activator Inhibitor 2 (SERPINB2))

Andere Bezeichnung: SERPINB2

Substanzklasse: Amino Acid

Hintergrund: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Autophagie