SGK1 Antikörper (N-Term)

Produktnummer ABIN634587

Produktdetails anti-SGK1 Antikörper

Target: SGK1 (serum/glucocorticoid Regulated Kinase 1 (SGK1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SGK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SGK1 antibody was raised against the N terminal of SGK1

Aufreinigung: Affinity purified

Immunogen: SGK1 antibody was raised using the N terminal of SGK1 corresponding to a region with amino acids ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SGK1 Blocking Peptide, catalog no. 33R-1406, is also available for use as a blocking control in assays to test for specificity of this SGK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SGK1

Target: SGK1 (serum/glucocorticoid Regulated Kinase 1 (SGK1))

Andere Bezeichnung: SGK1 (SGK1 Produkte)

Synonyme: SGK antikoerper, Sgk antikoerper, sgk-B antikoerper, sgk2 antikoerper, cb1083 antikoerper, sgk antikoerper, wu:fc20a09 antikoerper, sgk-A antikoerper, sgk1 antikoerper, sgk1-a antikoerper, sgk1-b antikoerper, serum/glucocorticoid regulated kinase 1 antikoerper, Serine/threonine-protein kinase sgk-1 antikoerper, serum/glucocorticoid regulated kinase 1 S homeolog antikoerper, serum/glucocorticoid regulated kinase 1 L homeolog antikoerper, SGK1 antikoerper, Sgk1 antikoerper, sgk-1 antikoerper, sgk1.S antikoerper, sgk1 antikoerper, sgk1.L antikoerper

Hintergrund: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: MAPK Signalweg, Notch Signalweg, Steroid Hormone Mediated Signaling Pathway