TAPBP Antikörper
-
- Target Alle TAPBP Antikörper anzeigen
- TAPBP (TAP Binding Protein (Tapasin) (TAPBP))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TAPBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
- Top Product
- Discover our top product TAPBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TAPBP Blocking Peptide, catalog no. 33R-3219, is also available for use as a blocking control in assays to test for specificity of this TAPBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAPBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TAPBP (TAP Binding Protein (Tapasin) (TAPBP))
- Andere Bezeichnung
- TAPBP (TAPBP Produkte)
- Synonyme
- SI:dZ179B20.1 antikoerper, SI:dZ179B20.3 antikoerper, SI:dZ179B20.7 antikoerper, mhc1uda antikoerper, mhc1ufa antikoerper, tpsn antikoerper, zgc:109814 antikoerper, tapbp antikoerper, TAPBP antikoerper, D17Wsu91e antikoerper, TPN antikoerper, NGS17 antikoerper, TAPA antikoerper, TPSN antikoerper, TAP binding protein (tapasin), tandem duplicate 1 antikoerper, TAP binding protein antikoerper, tapbp.1 antikoerper, tapbp antikoerper, TAPBP antikoerper, Tapbp antikoerper
- Hintergrund
- TAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.
- Molekulargewicht
- 46 kDa (MW of target protein)
-