EPOR Antikörper (N-Term)

Produktnummer ABIN634567

Produktdetails anti-EPOR Antikörper

Target: EPOR (Erythropoietin Receptor (EPOR))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPOR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EPOr antibody was raised against the N terminal of EPOR

Aufreinigung: Affinity purified

Immunogen: EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPOr Blocking Peptide, catalog no. 33R-1978, is also available for use as a blocking control in assays to test for specificity of this EPOr antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPOR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPOR

Target: EPOR (Erythropoietin Receptor (EPOR))

Andere Bezeichnung: EPOr (EPOR Produkte)

Synonyme: EPOR antikoerper, epor antikoerper, EPO-R antikoerper, erythropoietin receptor antikoerper, erythropoietin receptor L homeolog antikoerper, EPOR antikoerper, epor antikoerper, Epor antikoerper, epor.L antikoerper

Hintergrund: The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg