FcRn Antikörper (N-Term)

Produktnummer ABIN634564

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FcRn in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FcRn Antikörper (N-Term) (ABIN634564)

Target: FcRn (neonatal Fc Receptor (FcRn))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FcRn Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FcRn Antikörper

Bindungsspezifität: N-Term

Spezifität: FCGRT antibody was raised against the N terminal of FCGRT

Aufreinigung: Affinity purified

Immunogen: FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FCGRT Blocking Peptide, (ABIN939053), is also available for use as a blocking control in assays to test for specificity of this FCGRT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCGRT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FcRn

Target: FcRn (neonatal Fc Receptor (FcRn))

Andere Bezeichnung: FCGRT

Hintergrund: FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process