CD8B Antikörper (N-Term)
-
- Target Alle CD8B Antikörper anzeigen
- CD8B (CD8b Molecule (CD8B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CD8B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CD8 B antibody was raised against the N terminal of CD8
- Aufreinigung
- Affinity purified
- Immunogen
- CD8 B antibody was raised using the N terminal of CD8 corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI
- Top Product
- Discover our top product CD8B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CD8B Blocking Peptide, catalog no. 33R-7989, is also available for use as a blocking control in assays to test for specificity of this CD8B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD8B (CD8b Molecule (CD8B))
- Andere Bezeichnung
- CD8B (CD8B Produkte)
- Synonyme
- Cd8b antikoerper, Ly-3 antikoerper, Ly-C antikoerper, Lyt-3 antikoerper, CD8B1 antikoerper, LEU2 antikoerper, LY3 antikoerper, LYT3 antikoerper, P37 antikoerper, Cd8b1 antikoerper, CD8b molecule antikoerper, CD8 antigen, beta chain 1 antikoerper, Cd8b antikoerper, CD8B antikoerper, Cd8b1 antikoerper
- Hintergrund
- The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognise antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- T-Zell Rezeptor Signalweg
-