CD8B Antikörper (N-Term)

Produktnummer ABIN634561

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CD8B in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CD8B Antikörper (N-Term) (ABIN634561)

Target: CD8B (CD8b Molecule (CD8B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD8B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CD8B Antikörper

Bindungsspezifität: N-Term

Spezifität: CD8 B antibody was raised against the N terminal of CD8

Aufreinigung: Affinity purified

Immunogen: CD8 B antibody was raised using the N terminal of CD8 corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CD8B Blocking Peptide, (ABIN5612764), is also available for use as a blocking control in assays to test for specificity of this CD8B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CD8B

Target: CD8B (CD8b Molecule (CD8B))

Andere Bezeichnung: CD8B

Hintergrund: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognise antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg