RHOT1 Antikörper (N-Term)

Produktnummer ABIN634526

Der Kaninchen Polyklonal Anti-RHOT1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, RHOT1 in Proben von Human, Maus und Hund zu detektieren.

Kurzübersicht für RHOT1 Antikörper (N-Term) (ABIN634526)

Target: RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RHOT1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RHOT1 antibody was raised against the N terminal of RHOT1

Aufreinigung: Affinity purified

Immunogen: RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHOT1 Blocking Peptide, (ABIN5615864), is also available for use as a blocking control in assays to test for specificity of this RHOT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHOT1

Target: RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))

Andere Bezeichnung: RHOT1

Hintergrund: Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Molekulargewicht: 71 kDa (MW of target protein)