FKBP8 Antikörper (N-Term)

Produktnummer ABIN634523

Der Kaninchen Polyklonal Anti-FKBP8-Antikörper wurde für WB validiert. Er ist geeignet, FKBP8 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für FKBP8 Antikörper (N-Term) (ABIN634523)

Target: FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FKBP8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FKBP8 Antikörper

Bindungsspezifität: N-Term

Spezifität: FKBP8 antibody was raised against the N terminal of FKBP8

Aufreinigung: Affinity purified

Immunogen: FKBP8 antibody was raised using the N terminal of FKBP8 corresponding to a region with amino acids GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FKBP8 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FKBP8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FKBP8

Target: FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))

Andere Bezeichnung: FKBP8

Hintergrund: FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Autophagie