GPR177/WLS Antikörper (Middle Region)

Produktnummer ABIN634518

Der Kaninchen Polyklonal anti-GPR177/WLS Antikörper (ABIN634518) detektiert spezifisch GPR177/WLS in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für GPR177/WLS Antikörper (Middle Region) (ABIN634518)

Target: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPR177/WLS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GPR177/WLS Antikörper

Bindungsspezifität: Middle Region

Spezifität: GPR177 antibody was raised against the middle region of GPR177

Aufreinigung: Affinity purified

Immunogen: GPR177 antibody was raised using the middle region of GPR177 corresponding to a region with amino acids DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPR177 Blocking Peptide, (ABIN937391), is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR177 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPR177/WLS

Target: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Andere Bezeichnung: GPR177

Hintergrund: GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: WNT Signalweg