Beclin 1 Antikörper (N-Term)

Produktnummer ABIN634508

Der Kaninchen Polyklonal anti-Beclin 1 Antikörper wird verwendet zum Nachweis von Beclin 1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Beclin 1 Antikörper (N-Term) (ABIN634508)

Target: Beclin 1 (BECN1) (Beclin 1, Autophagy Related (BECN1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Beclin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Beclin 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: BECN1 antibody was raised against the N terminal of BECN1

Aufreinigung: Affinity purified

Immunogen: BECN1 antibody was raised using the N terminal of BECN1 corresponding to a region with amino acids MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BECN1 Blocking Peptide, (ABIN5612311), is also available for use as a blocking control in assays to test for specificity of this BECN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BECN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Beclin 1

Target: Beclin 1 (BECN1) (Beclin 1, Autophagy Related (BECN1))

Andere Bezeichnung: BECN1

Hintergrund: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Autophagie