PRKAA1 Antikörper (N-Term)
-
- Target Alle PRKAA1 Antikörper anzeigen
- PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRKAA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKAA1 antibody was raised against the N terminal of PRKAA1
- Aufreinigung
- Affinity purified
- Immunogen
- PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH
- Top Product
- Discover our top product PRKAA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKAA1 Blocking Peptide, catalog no. 33R-3235, is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))
- Andere Bezeichnung
- PRKAA1 (PRKAA1 Produkte)
- Synonyme
- AMPK antikoerper, AMPKa1 antikoerper, cb116 antikoerper, im:7154392 antikoerper, sb:cb130 antikoerper, wu:fa94c10 antikoerper, AMPK1 antikoerper, AMPKalpha1 antikoerper, AI194361 antikoerper, AI450832 antikoerper, AL024255 antikoerper, C130083N04Rik antikoerper, ampk antikoerper, ampka1 antikoerper, PRKAA1 antikoerper, protein kinase AMP-activated catalytic subunit alpha 1 antikoerper, protein kinase, AMP-activated, alpha 1 catalytic subunit antikoerper, protein kinase, AMP-activated, alpha 1 catalytic subunit L homeolog antikoerper, PRKAA1 antikoerper, prkaa1 antikoerper, Prkaa1 antikoerper, prkaa1.L antikoerper
- Hintergrund
- PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effekt
-