Fetuin A Antikörper (N-Term)
-
- Target Alle Fetuin A (AHSG) Antikörper anzeigen
- Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fetuin A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AHSG antibody was raised against the N terminal of AHSG
- Aufreinigung
- Affinity purified
- Immunogen
- AHSG antibody was raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
- Top Product
- Discover our top product AHSG Primärantikörper
-
anti-alpha-2-HS-Glycoprotein (AHSG) (AA 200-240) antibody (Alexa Fluor 594)
AHSG Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal Alexa Fluor 594
anti-alpha-2-HS-Glycoprotein (AHSG) antibodyAHSG Reaktivität: Human, Maus, Ratte IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-alpha-2-HS-Glycoprotein (AHSG) (AA 19-250) antibodyAHSG Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-alpha-2-HS-Glycoprotein (AHSG) (AA 247-276), (C-Term) antibodyAHSG Reaktivität: Human WB, IF, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB18674 unconjugated
anti-alpha-2-HS-Glycoprotein (AHSG) (AA 201-300) antibodyAHSG Reaktivität: Maus WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-alpha-2-HS-Glycoprotein (AHSG) (AA 19-359) antibodyAHSG Reaktivität: Rind (Kuh) WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-alpha-2-HS-Glycoprotein (AHSG) (AA 19-367) antibodyAHSG Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 1D8 unconjugated
anti-alpha-2-HS-Glycoprotein (AHSG) antibodyAHSG Reaktivität: Human WB, IHC, FACS, IHC (p) Wirt: Maus Monoclonal 2H2 unconjugated
anti-alpha-2-HS-Glycoprotein (AHSG) antibodyAHSG Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-alpha-2-HS-Glycoprotein (AHSG) (AA 1-367) antibodyAHSG Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AHSG Blocking Peptide, catalog no. 33R-1451, is also available for use as a blocking control in assays to test for specificity of this AHSG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHSG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))
- Andere Bezeichnung
- AHSG (AHSG Produkte)
- Synonyme
- ahs antikoerper, a2hs antikoerper, hsga antikoerper, fetua antikoerper, wu:fb63g02 antikoerper, zgc:103687 antikoerper, AHSG antikoerper, MGC116429 antikoerper, A2HS antikoerper, AHS antikoerper, FETUA antikoerper, HSGA antikoerper, Aa2-066 antikoerper, pp63 antikoerper, alpha-2-HS-glycoprotein antikoerper, alpha 2-HS glycoprotein antikoerper, alpha-2-HS-glycoprotein 1 antikoerper, alpha-2-HS-glycoprotein L homeolog antikoerper, Cphamn1_1981 antikoerper, AHSG antikoerper, ahsg antikoerper, ahsg1 antikoerper, ahsg.L antikoerper, Ahsg antikoerper
- Hintergrund
- Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.
- Molekulargewicht
- 39 kDa (MW of target protein)
-
