Fetuin A Antikörper (N-Term)

Produktnummer ABIN634489

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Fetuin A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Fetuin A Antikörper (N-Term) (ABIN634489)

Target: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fetuin A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Fetuin A Antikörper

Bindungsspezifität: N-Term

Spezifität: AHSG antibody was raised against the N terminal of AHSG

Aufreinigung: Affinity purified

Immunogen: AHSG antibody was raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AHSG Blocking Peptide, (ABIN936837), is also available for use as a blocking control in assays to test for specificity of this AHSG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHSG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Fetuin A

Target: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Andere Bezeichnung: AHSG

Hintergrund: Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.

Molekulargewicht: 39 kDa (MW of target protein)