G3BP1 Antikörper
-
- Target Alle G3BP1 Antikörper anzeigen
- G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser G3BP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- G3 BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
- Top Product
- Discover our top product G3BP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
G3BP1 Blocking Peptide, catalog no. 33R-7905, is also available for use as a blocking control in assays to test for specificity of this G3BP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))
- Andere Bezeichnung
- G3BP1 (G3BP1 Produkte)
- Hintergrund
- This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-