ADAR Antikörper (N-Term)
-
- Target Alle ADAR Antikörper anzeigen
- ADAR (Adenosine Deaminase, RNA-Specific (ADAR))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ADAR antibody was raised against the N terminal of ADAR
- Aufreinigung
- Affinity purified
- Immunogen
- ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS
- Top Product
- Discover our top product ADAR Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADAR Blocking Peptide, catalog no. 33R-3228, is also available for use as a blocking control in assays to test for specificity of this ADAR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAR (Adenosine Deaminase, RNA-Specific (ADAR))
- Andere Bezeichnung
- ADAR (ADAR Produkte)
- Synonyme
- red1 antikoerper, drada antikoerper, wu:fc22a02 antikoerper, adar1 antikoerper, dsRAD antikoerper, dsRAD-1 antikoerper, ADAR antikoerper, ADAR1 antikoerper, CG12598 antikoerper, Dmel\\CG12598 antikoerper, EG:BACN35H14.1 antikoerper, adar antikoerper, adr antikoerper, cg12598 antikoerper, dADAR antikoerper, dAdar antikoerper, hypnos-2 antikoerper, NV18763 antikoerper, AGS6 antikoerper, DRADA antikoerper, DSH antikoerper, DSRAD antikoerper, G1P1 antikoerper, IFI-4 antikoerper, IFI4 antikoerper, K88DSRBP antikoerper, P136 antikoerper, AV242451 antikoerper, Adar1 antikoerper, mZaADAR antikoerper, adenosine deaminase, RNA-specific antikoerper, adenosine deaminase, RNA-specific S homeolog antikoerper, adenosine deaminase, RNA specific antikoerper, Adenosine deaminase acting on RNA antikoerper, adenosine deaminase acting on RNA antikoerper, double-stranded RNA-specific editase 1 antikoerper, adar antikoerper, adar.S antikoerper, ADAR antikoerper, Adar antikoerper, CpipJ_CPIJ011849 antikoerper, LOC100114127 antikoerper
- Hintergrund
- ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Molekulargewicht
- 136 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-