ADAR Antikörper (N-Term)

Produktnummer ABIN634454

Produktdetails anti-ADAR Antikörper

Target: ADAR (Adenosine Deaminase, RNA-Specific (ADAR))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADAR antibody was raised against the N terminal of ADAR

Aufreinigung: Affinity purified

Immunogen: ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAR Blocking Peptide, catalog no. 33R-3228, is also available for use as a blocking control in assays to test for specificity of this ADAR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAR

Target: ADAR (Adenosine Deaminase, RNA-Specific (ADAR))

Andere Bezeichnung: ADAR (ADAR Produkte)

Hintergrund: ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Molekulargewicht: 136 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus