NKIRAS2 Antikörper (Middle Region)

Produktnummer ABIN634432

Produktdetails anti-NKIRAS2 Antikörper

Target: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NKIRAS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NKIRAS2 antibody was raised against the middle region of NKIRAS2

Aufreinigung: Affinity purified

Immunogen: NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NKIRAS2 Blocking Peptide, catalog no. 33R-4460, is also available for use as a blocking control in assays to test for specificity of this NKIRAS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NKIRAS2

Target: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Andere Bezeichnung: NKIRAS2 (NKIRAS2 Produkte)

Synonyme: NKIRAS2 antikoerper, KBRAS2 antikoerper, kappaB-Ras2 antikoerper, zgc:92870 antikoerper, 2410003M04Rik antikoerper, 4930527H08Rik antikoerper, D630018G21Rik antikoerper, NFKB inhibitor interacting Ras like 2 antikoerper, NFKB inhibitor interacting Ras-like 2 antikoerper, NFKB inhibitor interacting Ras like 2 L homeolog antikoerper, NFKB inhibitor interacting Ras-like protein 2 antikoerper, NKIRAS2 antikoerper, Nkiras2 antikoerper, nkiras2 antikoerper, nkiras2.L antikoerper

Hintergrund: NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

Molekulargewicht: 21 kDa (MW of target protein)