NKIRAS2 Antikörper (Middle Region)

Produktnummer ABIN634432

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch NKIRAS2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für NKIRAS2 Antikörper (Middle Region) (ABIN634432)

Target: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NKIRAS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NKIRAS2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NKIRAS2 antibody was raised against the middle region of NKIRAS2

Aufreinigung: Affinity purified

Immunogen: NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NKIRAS2 Blocking Peptide, (ABIN939846), is also available for use as a blocking control in assays to test for specificity of this NKIRAS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NKIRAS2

Target: NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))

Andere Bezeichnung: NKIRAS2

Hintergrund: NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.

Molekulargewicht: 21 kDa (MW of target protein)