PLCD1 Antikörper (N-Term)

Produktnummer ABIN634425

Produktdetails anti-PLCD1 Antikörper

Target: PLCD1 (phospholipase C, delta 1 (PLCD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLCD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLCD1 antibody was raised against the N terminal of PLCD1

Aufreinigung: Affinity purified

Immunogen: PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLCD1 Blocking Peptide, catalog no. 33R-2003, is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLCD1

Target: PLCD1 (phospholipase C, delta 1 (PLCD1))

Andere Bezeichnung: PLCD1 (PLCD1 Produkte)

Synonyme: NDNC3 antikoerper, PLC-III antikoerper, AW212592 antikoerper, C79986 antikoerper, Plc1 antikoerper, phospholipase C delta 1 antikoerper, phospholipase C, delta 1 antikoerper, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 antikoerper, PLCD1 antikoerper, Plcd1 antikoerper, LOC790012 antikoerper

Hintergrund: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: WNT Signalweg, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process