PLCD1 Antikörper (N-Term)

Produktnummer ABIN634425

Dieses Anti-PLCD1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PLCD1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PLCD1 Antikörper (N-Term) (ABIN634425)

Target: PLCD1 (phospholipase C, delta 1 (PLCD1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLCD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLCD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: PLCD1 antibody was raised against the N terminal of PLCD1

Aufreinigung: Affinity purified

Immunogen: PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLCD1 Blocking Peptide, (ABIN937389), is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLCD1

Target: PLCD1 (phospholipase C, delta 1 (PLCD1))

Andere Bezeichnung: PLCD1

Hintergrund: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: WNT Signalweg, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process