SOCS7 Antikörper (N-Term)

Produktnummer ABIN634408

Produktdetails anti-SOCS7 Antikörper

Target: SOCS7 (Suppressor of Cytokine Signaling 7 (SOCS7))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SOCS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SOCS7 antibody was raised against the N terminal of SOCS7

Aufreinigung: Affinity purified

Immunogen: SOCS7 antibody was raised using the N terminal of SOCS7 corresponding to a region with amino acids LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SOCS7 Blocking Peptide, catalog no. 33R-4853, is also available for use as a blocking control in assays to test for specificity of this SOCS7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOCS7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SOCS7

Target: SOCS7 (Suppressor of Cytokine Signaling 7 (SOCS7))

Andere Bezeichnung: SOCS7 (SOCS7 Produkte)

Synonyme: NAP4 antikoerper, NCKAP4 antikoerper, SOCS4 antikoerper, SOCS6 antikoerper, 2310063P06Rik antikoerper, C85125 antikoerper, Nap4 antikoerper, GB13951 antikoerper, zgc:175115 antikoerper, SOCS7 antikoerper, socs7 antikoerper, suppressor of cytokine signaling 7 antikoerper, suppressor of cytokine signaling antikoerper, SOCS7 antikoerper, Socs7 antikoerper, LOC413772 antikoerper, socs7 antikoerper

Hintergrund: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molekulargewicht: 64 kDa (MW of target protein)