SOCS7 Antikörper (N-Term)

Produktnummer ABIN634408

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SOCS7 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SOCS7 Antikörper (N-Term) (ABIN634408)

Target: SOCS7 (Suppressor of Cytokine Signaling 7 (SOCS7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SOCS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SOCS7 Antikörper

Bindungsspezifität: N-Term

Spezifität: SOCS7 antibody was raised against the N terminal of SOCS7

Aufreinigung: Affinity purified

Immunogen: SOCS7 antibody was raised using the N terminal of SOCS7 corresponding to a region with amino acids LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SOCS7 Blocking Peptide, (ABIN940239), is also available for use as a blocking control in assays to test for specificity of this SOCS7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOCS7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SOCS7

Target: SOCS7 (Suppressor of Cytokine Signaling 7 (SOCS7))

Andere Bezeichnung: SOCS7

Hintergrund: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molekulargewicht: 64 kDa (MW of target protein)