DGKA Antikörper (N-Term)

Produktnummer ABIN634379

Der Kaninchen Polyklonal Anti-DGKA-Antikörper wurde für WB validiert. Er ist geeignet, DGKA in Proben von Human zu detektieren.

Kurzübersicht für DGKA Antikörper (N-Term) (ABIN634379)

Target: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DGKA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DGKA Antikörper

Bindungsspezifität: N-Term

Spezifität: DGKA antibody was raised against the N terminal of DGKA

Aufreinigung: Affinity purified

Immunogen: DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DGKA Blocking Peptide, (ABIN937817), is also available for use as a blocking control in assays to test for specificity of this DGKA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DGKA

Target: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Andere Bezeichnung: DGKA

Hintergrund: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways.

Molekulargewicht: 83 kDa (MW of target protein)