DDAH2 Antikörper (N-Term)

Produktnummer ABIN634365

Produktdetails anti-DDAH2 Antikörper

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDAH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DDAH2 antibody was raised against the N terminal of DDAH2

Aufreinigung: Affinity purified

Immunogen: DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDAH2 Blocking Peptide, catalog no. 33R-6631, is also available for use as a blocking control in assays to test for specificity of this DDAH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDAH2

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Andere Bezeichnung: DDAH2 (DDAH2 Produkte)

Synonyme: ddah2 antikoerper, MGC84290 antikoerper, g6a antikoerper, ddah antikoerper, ng30 antikoerper, ddahii antikoerper, MGC89103 antikoerper, DDAH2 antikoerper, DDAH antikoerper, DDAHII antikoerper, G6a antikoerper, NG30 antikoerper, 1110003M04Rik antikoerper, AU019324 antikoerper, AW413173 antikoerper, DDAH-2 antikoerper, Ddah antikoerper, dimethylarginine dimethylaminohydrolase 2 antikoerper, dimethylarginine dimethylaminohydrolase 2 L homeolog antikoerper, ddah2 antikoerper, ddah2.L antikoerper, DDAH2 antikoerper, Ddah2 antikoerper

Hintergrund: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.

Molekulargewicht: 31 kDa (MW of target protein)