DDAH2 Antikörper (N-Term)

Produktnummer ABIN634365

This anti-DDAH2 antibody (ABIN634365) is a Rabbit Polyclonal antibody detecting DDAH2 in WB. Suitable for Human, Mouse, Rat.

Kurzübersicht für DDAH2 Antikörper (N-Term) (ABIN634365)

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDAH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDAH2 Antikörper

Bindungsspezifität: N-Term

Spezifität: DDAH2 antibody was raised against the N terminal of DDAH2

Aufreinigung: Affinity purified

Immunogen: DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDAH2 Blocking Peptide, catalog no. 33R-6631, is also available for use as a blocking control in assays to test for specificity of this DDAH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDAH2

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Andere Bezeichnung: DDAH2

Hintergrund: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.

Molekulargewicht: 31 kDa (MW of target protein)