DVL2 Antikörper

Produktnummer ABIN634352

Produktdetails anti-DVL2 Antikörper

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DVL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DVL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DVL2 Blocking Peptide, catalog no. 33R-1228, is also available for use as a blocking control in assays to test for specificity of this DVL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DVL2

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Andere Bezeichnung: DVL2 (DVL2 Produkte)

Synonyme: Xdsh antikoerper, dishevelled antikoerper, dsh antikoerper, dvl antikoerper, Dvl-2 antikoerper, xdsh antikoerper, wu:fc05d12 antikoerper, wu:fo71e09 antikoerper, wu:fp54a02 antikoerper, zgc:55372 antikoerper, dishevelled segment polarity protein 2 antikoerper, dishevelled segment polarity protein 2 L homeolog antikoerper, DVL2 antikoerper, dvl2 antikoerper, Dvl2 antikoerper, dvl2.L antikoerper

Hintergrund: DVL2 is a member of the dishevelled (dsh) protein family. It is a 90 kDa protein that undergoes posttranslational phosphorylation to form a 95 kDa cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

Molekulargewicht: 79 kDa (MW of target protein)

Pathways: Tube Formation