CAMKII gamma Antikörper (N-Term)

Produktnummer ABIN634349

Produktdetails anti-CAMKII gamma Antikörper

Target: CAMKII gamma (CAMK2G) (Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAMKII gamma Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CAMKII antibody was raised against the N terminal of CAMKK2

Aufreinigung: Affinity purified

Immunogen: CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAMKII Blocking Peptide, catalog no. 33R-3291, is also available for use as a blocking control in assays to test for specificity of this CAMKII antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMKK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAMKII gamma

Target: CAMKII gamma (CAMK2G) (Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G))

Andere Bezeichnung: CAMKII (CAMK2G Produkte)

Synonyme: CAMK antikoerper, CAMK-II antikoerper, CAMKG antikoerper, 5930429P18Rik antikoerper, Camkg antikoerper, calcium/calmodulin dependent protein kinase II gamma antikoerper, calcium/calmodulin-dependent protein kinase II gamma antikoerper, CAMK2G antikoerper, Camk2g antikoerper

Hintergrund: CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: WNT Signalweg, Interferon-gamma Pathway, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of long-term Neuronal Synaptic Plasticity