FYN Antikörper (N-Term)

Produktnummer ABIN634345

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FYN in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für FYN Antikörper (N-Term) (ABIN634345)

Target: FYN (FYN Oncogene Related To SRC, FGR, YES (FYN))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FYN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FYN Antikörper

Bindungsspezifität: N-Term

Spezifität: FYN antibody was raised against the N terminal of FYN

Aufreinigung: Affinity purified

Immunogen: FYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FYN Blocking Peptide, (ABIN938579), is also available for use as a blocking control in assays to test for specificity of this FYN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FYN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FYN

Target: FYN (FYN Oncogene Related To SRC, FGR, YES (FYN))

Andere Bezeichnung: FYN

Hintergrund: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Activated T Cell Proliferation, Thromboxane A2 Receptor Signaling