SHB Antikörper (N-Term)

Produktnummer ABIN634335

Produktdetails anti-SHB Antikörper

Target: SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SHB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SHB antibody was raised against the N terminal of SHB

Aufreinigung: Affinity purified

Immunogen: SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SHB Blocking Peptide, catalog no. 33R-2710, is also available for use as a blocking control in assays to test for specificity of this SHB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SHB

Target: SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))

Andere Bezeichnung: SHB (SHB Produkte)

Synonyme: SHB antikoerper, RP11-3J10.8 antikoerper, bA3J10.2 antikoerper, RGD1565350 antikoerper, BC028832 antikoerper, SH2 domain containing adaptor protein B antikoerper, src homology 2 domain-containing transforming protein B antikoerper, SHB antikoerper, Shb antikoerper

Hintergrund: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Molekulargewicht: 55 kDa (MW of target protein)