RGS19 Antikörper (N-Term)

Produktnummer ABIN634327

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RGS19 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für RGS19 Antikörper (N-Term) (ABIN634327)

Target: RGS19 (Regulator of G-Protein Signalling 19 (RGS19))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RGS19 Antikörper

Bindungsspezifität: N-Term

Spezifität: RGS19 antibody was raised against the N terminal of RGS19

Aufreinigung: Affinity purified

Immunogen: RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS19 Blocking Peptide, (ABIN5615845), is also available for use as a blocking control in assays to test for specificity of this RGS19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS19

Target: RGS19 (Regulator of G-Protein Signalling 19 (RGS19))

Andere Bezeichnung: RGS19

Hintergrund: G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling