Galectin 9 Antikörper

Produktnummer ABIN634316

Produktdetails anti-Galectin 9 Antikörper

Target: Galectin 9 (LGALS9) (Lectin, Galactoside-Binding, Soluble, 9 (LGALS9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Galectin 9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LGALS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LGALS9 Blocking Peptide, catalog no. 33R-10199, is also available for use as a blocking control in assays to test for specificity of this LGALS9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Galectin 9

Target: Galectin 9 (LGALS9) (Lectin, Galactoside-Binding, Soluble, 9 (LGALS9))

Andere Bezeichnung: LGALS9 (LGALS9 Produkte)

Hintergrund: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS9 is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H+RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency.

Molekulargewicht: 39 kDa (MW of target protein)