B-Cell Linker Antikörper (Middle Region)

Produktnummer ABIN634309

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch B-Cell Linker in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für B-Cell Linker Antikörper (Middle Region) (ABIN634309)

Target: B-Cell Linker (BLNK)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B-Cell Linker Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-B-Cell Linker Antikörper

Bindungsspezifität: Middle Region

Spezifität: BLNK antibody was raised against the middle region of BLNK

Aufreinigung: Affinity purified

Immunogen: BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BLNK Blocking Peptide, (ABIN5612338), is also available for use as a blocking control in assays to test for specificity of this BLNK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLNK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B-Cell Linker

Target: B-Cell Linker (BLNK)

Andere Bezeichnung: BLNK

Hintergrund: This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: BCR Signaling