ERAS Antikörper (Middle Region)

Produktnummer ABIN634304

Produktdetails anti-ERAS Antikörper

Target: ERAS (ES cell expressed Ras (ERAS))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ERAS antibody was raised against the middle region of ERAS

Aufreinigung: Affinity purified

Immunogen: ERAS antibody was raised using the middle region of ERAS corresponding to a region with amino acids AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERAS Blocking Peptide, catalog no. 33R-1453, is also available for use as a blocking control in assays to test for specificity of this ERAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERAS

Target: ERAS (ES cell expressed Ras (ERAS))

Andere Bezeichnung: ERAS (ERAS Produkte)

Synonyme: HRAS2 antikoerper, HRASP antikoerper, HRasp antikoerper, Ha-Ras2 antikoerper, ecat5 antikoerper, ES cell expressed Ras antikoerper, ES cell-expressed Ras antikoerper, ERAS antikoerper, Eras antikoerper

Hintergrund: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.

Molekulargewicht: 25 kDa (MW of target protein)