S100A9 Antikörper (N-Term)

Produktnummer ABIN634289

Produktdetails anti-S100A9 Antikörper

Target: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser S100A9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: S100 A9 antibody was raised against the N terminal of S100 9

Aufreinigung: Affinity purified

Immunogen: S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

S100A9 Blocking Peptide, catalog no. 33R-6535, is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu S100A9

Target: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Andere Bezeichnung: S100A9 (S100A9 Produkte)

Synonyme: 60B8AG antikoerper, CAGB antikoerper, CFAG antikoerper, CGLB antikoerper, L1AG antikoerper, LIAG antikoerper, MAC387 antikoerper, MIF antikoerper, MRP14 antikoerper, NIF antikoerper, P14 antikoerper, Mrp14 antikoerper, S100A9 antikoerper, MRP-14 antikoerper, p14 antikoerper, 60B8Ag antikoerper, AW546964 antikoerper, BEE22 antikoerper, Cagb antikoerper, GAGB antikoerper, L1Ag antikoerper, S100 calcium binding protein A9 antikoerper, S100 calcium binding protein A9 (calgranulin B) antikoerper, S100A9 antikoerper, S100a9 antikoerper

Hintergrund: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.

Molekulargewicht: 13 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, S100 Proteine