S100A9 Antikörper (N-Term)

Produktnummer ABIN634289

Der Kaninchen Polyklonal Anti-S100A9-Antikörper wurde für WB validiert. Er ist geeignet, S100A9 in Proben von Human zu detektieren.

Kurzübersicht für S100A9 Antikörper (N-Term) (ABIN634289)

Target: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser S100A9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-S100A9 Antikörper

Bindungsspezifität: N-Term

Spezifität: S100 A9 antibody was raised against the N terminal of S100 9

Aufreinigung: Affinity purified

Immunogen: S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

S100A9 Blocking Peptide, catalog no. 33R-6535, is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu S100A9

Target: S100A9 (S100 Calcium Binding Protein A9 (S100A9))

Andere Bezeichnung: S100A9

Hintergrund: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.

Molekulargewicht: 13 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, S100 Proteine