PDGFB Antikörper (N-Term)

Produktnummer ABIN634264

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PDGFB in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte, Maus und Hund.

Kurzübersicht für PDGFB Antikörper (N-Term) (ABIN634264)

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDGFB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDGFB Antikörper

Bindungsspezifität: N-Term

Spezifität: PDGFB antibody was raised against the N terminal of PDGFB

Aufreinigung: Affinity purified

Immunogen: PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDGFB Blocking Peptide, catalog no. 33R-6853, is also available for use as a blocking control in assays to test for specificity of this PDGFB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDGFB

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Andere Bezeichnung: PDGFB

Hintergrund: PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling