Presenilin 2 Antikörper

Produktnummer ABIN634258

Produktdetails anti-Presenilin 2 Antikörper

Target: Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Presenilin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: Presenilin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Presenilin 2 Blocking Peptide, catalog no. 33R-9902, is also available for use as a blocking control in assays to test for specificity of this Presenilin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSEN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Presenilin 2

Target: Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))

Andere Bezeichnung: Presenilin 2 (PSEN2 Produkte)

Synonyme: AD3L antikoerper, AD4 antikoerper, CMD1V antikoerper, PS2 antikoerper, STM2 antikoerper, ALG-3 antikoerper, Ad4h antikoerper, Alg3 antikoerper, PS-2 antikoerper, Psnl2 antikoerper, pre2 antikoerper, zf-PS2 antikoerper, PSNL2 antikoerper, PSEN2 antikoerper, ad4 antikoerper, ps2 antikoerper, ad3l antikoerper, stm2 antikoerper, Ps2 antikoerper, presenilin 2 antikoerper, presenilin 2 S homeolog antikoerper, presenilin 2 (Alzheimer disease 4) antikoerper, trefoil factor 1 antikoerper, PSEN2 antikoerper, Psen2 antikoerper, psen2 antikoerper, psen2.S antikoerper, Tff1 antikoerper

Hintergrund: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Notch Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung