Kallikrein 10 Antikörper (N-Term)

Produktnummer ABIN634235

Der Kaninchen Polyklonal Anti-Kallikrein 10-Antikörper wurde für WB validiert. Er ist geeignet, Kallikrein 10 in Proben von Human zu detektieren.

Kurzübersicht für Kallikrein 10 Antikörper (N-Term) (ABIN634235)

Target: Kallikrein 10 (KLK10)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kallikrein 10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Kallikrein 10 Antikörper

Bindungsspezifität: N-Term

Spezifität: KLK10 antibody was raised against the N terminal of KLK10

Aufreinigung: Affinity purified

Immunogen: KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLK10 Blocking Peptide, (ABIN5614388), is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Kallikrein 10

Target: Kallikrein 10 (KLK10)

Andere Bezeichnung: KLK10

Hintergrund: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Komplementsystem