RAD54B Antikörper
-
- Target Alle RAD54B Antikörper anzeigen
- RAD54B (DNA repair and recombination protein RAD54B (RAD54B))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAD54B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN
- Top Product
- Discover our top product RAD54B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAD54B Blocking Peptide, catalog no. 33R-8160, is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD54B (DNA repair and recombination protein RAD54B (RAD54B))
- Andere Bezeichnung
- RAD54B (RAD54B Produkte)
- Hintergrund
- RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.
- Molekulargewicht
- 103 kDa (MW of target protein)
-