RAD54B Antikörper

Produktnummer ABIN634225

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RAD54B in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für RAD54B Antikörper (ABIN634225)

Target: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD54B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAD54B Antikörper

Aufreinigung: Affinity purified

Immunogen: RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD54B Blocking Peptide, (ABIN5615734), is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD54B

Target: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Andere Bezeichnung: RAD54B

Hintergrund: RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.

Molekulargewicht: 103 kDa (MW of target protein)