RAD54B Antikörper
-
- Target Alle RAD54B Antikörper anzeigen
- RAD54B (DNA repair and recombination protein RAD54B (RAD54B))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAD54B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV
- Top Product
- Discover our top product RAD54B Primärantikörper
-
anti-DNA repair and recombination protein RAD54B (RAD54B) (C-Term) antibody
RAD54B Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) (AA 801-910) antibodyRAD54B Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 4A7 unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) (AA 1-167) antibodyRAD54B Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) (AA 1-158) antibodyRAD54B Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) (AA 68-102), (N-Term) antibodyRAD54B Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB50796 unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) (AA 821-910) antibodyRAD54B Reaktivität: Maus, Ratte WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) (AA 111-142) antibodyRAD54B Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB54407 unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) antibodyRAD54B Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) (AA 144-193) antibodyRAD54B Reaktivität: Human, Maus, Rind (Kuh), Hund, Pferd, Kaninchen, Schwein, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-DNA repair and recombination protein RAD54B (RAD54B) (N-Term) antibodyRAD54B Reaktivität: Human, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAD54B Blocking Peptide, catalog no. 33R-1865, is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD54B (DNA repair and recombination protein RAD54B (RAD54B))
- Andere Bezeichnung
- RAD54B (RAD54B Produkte)
- Synonyme
- RAD54B antikoerper, im:7137737 antikoerper, im:7153525 antikoerper, fsbp antikoerper, rdh54 antikoerper, RDH54 antikoerper, E130016E03Rik antikoerper, Fsbp antikoerper, RGD1306507 antikoerper, RAD54 homolog B (S. cerevisiae) antikoerper, RAD54 homolog B L homeolog antikoerper, RAD54B antikoerper, rad54b antikoerper, rad54b.L antikoerper, Rad54b antikoerper
- Hintergrund
- RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA.
- Molekulargewicht
- 103 kDa (MW of target protein)
-
