RAD54B Antikörper

Produktnummer ABIN634221

Dieses Anti-RAD54B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RAD54B in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für RAD54B Antikörper (ABIN634221)

Target: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD54B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAD54B Antikörper

Aufreinigung: Affinity purified

Immunogen: RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD54B Blocking Peptide, (ABIN937251), is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD54B

Target: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Andere Bezeichnung: RAD54B

Hintergrund: RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA.

Molekulargewicht: 103 kDa (MW of target protein)