DKC1 Antikörper (N-Term)
Kurzübersicht für DKC1 Antikörper (N-Term) (ABIN634217)
Target
Alle DKC1 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- DKC1 antibody was raised against the N terminal of DKC1
-
Aufreinigung
- Affinity purified
-
Immunogen
- DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
DKC1 Blocking Peptide, (ABIN937793), is also available for use as a blocking control in assays to test for specificity of this DKC1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKC1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))
-
Andere Bezeichnung
- DKC1
-
Hintergrund
- This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.
-
Molekulargewicht
- 58 kDa (MW of target protein)
-
Pathways
- Telomere Maintenance
Target
-