DKC1 Antikörper (N-Term)

Produktnummer ABIN634217

Der Kaninchen Polyklonal Anti-DKC1-Antikörper wurde für WB validiert. Er ist geeignet, DKC1 in Proben von Human zu detektieren.

Kurzübersicht für DKC1 Antikörper (N-Term) (ABIN634217)

Target: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DKC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DKC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: DKC1 antibody was raised against the N terminal of DKC1

Aufreinigung: Affinity purified

Immunogen: DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DKC1 Blocking Peptide, (ABIN937793), is also available for use as a blocking control in assays to test for specificity of this DKC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DKC1

Target: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Andere Bezeichnung: DKC1

Hintergrund: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Telomere Maintenance