TUBE1 Antikörper (Middle Region)

Produktnummer ABIN634213

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TUBE1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TUBE1 Antikörper (Middle Region) (ABIN634213)

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TUBE1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1

Aufreinigung: Affinity purified

Immunogen: Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Epsilon Tubulin 1 Blocking Peptide, (ABIN939163), is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBE1

Target: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Andere Bezeichnung: epsilon Tubulin 1

Hintergrund: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Microtubule Dynamics