Septin 2 Antikörper (N-Term)

Produktnummer ABIN634205

Der Kaninchen Polyklonal Anti-Septin 2-Antikörper wurde für WB validiert. Er ist geeignet, Septin 2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Septin 2 Antikörper (N-Term) (ABIN634205)

Target: Septin 2 (SEPT2)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Septin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Septin 2 Antikörper

Bindungsspezifität: N-Term

Spezifität: Septin 2 antibody was raised against the N terminal of 40423

Aufreinigung: Affinity purified

Immunogen: Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Septin 2 Blocking Peptide, (ABIN5616052), is also available for use as a blocking control in assays to test for specificity of this Septin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 37500 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Septin 2

Target: Septin 2 (SEPT2)

Andere Bezeichnung: Septin 2

Hintergrund: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Molekulargewicht: 41 kDa (MW of target protein)