SYCP1 Antikörper (N-Term)

Produktnummer ABIN634180

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SYCP1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SYCP1 Antikörper (N-Term) (ABIN634180)

Target: SYCP1 (Synaptonemal Complex Protein 1 (SYCP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SYCP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SYCP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SYCP1 antibody was raised against the N terminal of SYCP1

Aufreinigung: Affinity purified

Immunogen: SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SYCP1 Blocking Peptide, (ABIN5616464), is also available for use as a blocking control in assays to test for specificity of this SYCP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYCP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SYCP1

Target: SYCP1 (Synaptonemal Complex Protein 1 (SYCP1))

Andere Bezeichnung: SYCP1

Hintergrund: SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.

Molekulargewicht: 107 kDa (MW of target protein)